Back to Skills

Claude Code Video Toolkit

by Digital Samba

productivityintermediate
video-productionremotionelevenlabssprint-reviewproduct-demoai-videovoiceoverbrand-identityffmpegplaywrightclaude-code

Tell Claude 'create a sprint review video for our new auth feature' and watch it scaffold a Remotion project, generate scenes with animated code blocks and transitions, add AI-narrated voiceover, and render a production-ready MP4. That's not a future roadmap item. That's what this skill does right now. Before this toolkit existed, making a dev team video meant one of two painful paths: spend 3 hours in Premiere Pro manually syncing code screenshots with voiceover, or spend 2 hours wrestling with Remotion's API to programmatically build something that looked half-decent. Both paths ended the same way -- the sprint review video never got made because nobody had the time. The Claude Code Video Toolkit collapses that entire workflow into conversation. You describe what you want. Claude builds it. The skill gives Claude deep domain expertise in Remotion (React-based video framework), ElevenLabs (AI voiceover with voice cloning), FFmpeg (media processing), and Playwright (browser recording for live demos). It's not a thin wrapper -- it includes 11 pre-built video components (titles, callouts, code blocks, lower thirds, transitions), 3 project templates, and 7 custom transition effects including glitch, RGB split, and zoom blur. The slash command system makes the workflow feel native. /video creates or resumes a project. /scene-review opens a live preview in Remotion Studio so you can see each scene before rendering. /design lets you refine individual scenes visually. /brand manages your company's visual identity -- colors, fonts, logos, voice settings -- so every video matches your brand without manual configuration. /generate-voiceover handles AI narration. /record-demo captures browser interactions for product demo footage. Installation is a git clone and you're running. No complex build pipeline, no external services required for the basics. ElevenLabs and RunPod (cloud GPU rendering) are optional -- the core toolkit works with just Node.js and Claude Code. MIT licensed, so your company can fork it and customize the templates without legal friction. The brand profile system deserves special attention. Define your company's color palette, typography, ElevenLabs voice settings, and logo assets once. Every video Claude produces automatically inherits that identity. Change your brand colors? Update one profile and all future videos match.

Installation

git clone https://github.com/digitalsamba/claude-code-video-toolkit.git && cd claude-code-video-toolkit && cp .env.example .env && npm install

Key Features

  • Create full video projects from natural language -- describe the video, Claude builds scenes, transitions, and voiceover automatically
  • 11 pre-built Remotion components: titles, callouts, code blocks, lower thirds, animated transitions -- no manual React coding needed
  • AI voiceover with ElevenLabs integration, including voice cloning to capture and reuse custom voices across projects
  • Brand profile system: define colors, typography, logos, and voice settings once -- every video inherits your identity
  • Live preview with /scene-review in Remotion Studio before final render -- iterate on individual scenes visually
  • Browser demo recording with Playwright -- capture live product interactions for product demo videos
  • 7 custom transitions (glitch, RGB split, zoom blur, light leak, clock wipe, pixelate, checkerboard) plus all official Remotion transitions
  • Multi-session project lifecycle: start a video today, resume tomorrow, Claude remembers where you left off

Use Cases

  • You need a sprint review video by Friday. Instead of spending 3 hours in Premiere Pro, you tell Claude 'create a 2-minute sprint review covering the new auth feature, dashboard redesign, and API rate limiting' -- it generates a branded video with animated code demos, transition effects, and AI narration
  • Your marketing team wants product demo videos but your developers don't have time to learn video editing. Install this skill and any developer can produce polished demo videos by describing what the product does -- Claude handles the visual storytelling
  • You're building a developer education channel and need consistent, branded tutorial videos. Define your brand profile once, then produce videos with 'create a tutorial showing how to set up our SDK' -- every video matches your visual identity
  • Your team records Playwright browser tests anyway. With /record-demo, those same browser interactions become polished product demo footage with voiceover, titles, and transitions -- zero extra recording work
  • You need to localize a video for a different market. /redub replaces the voiceover while keeping all visual elements intact -- one command to produce a version with a different language or voice

Related Resources

Weekly AI Digest